PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 204aa    MW: 22159.1 Da    PI: 4.9213
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22041.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.35.4e-43371361100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkCa++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++ 
  KHN22041.1  37 PCAACKILRRKCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVTSMVYEASARIRDPVYGCAGAICQLQKQVNELQAQLAKAQG 135
                 7**********************************************************************************************9987 PP

      DUF260 100 e 100
                 e
  KHN22041.1 136 E 136
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.48336137IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-4337134IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MESSDTYTPT SSAPLSHSPS NSSSSSPPPP PTVVMSPCAA CKILRRKCAE KCVLAPYFPP  60
TEPAKFTIAH RVFGASNIIK FLQELPESQR ADAVTSMVYE ASARIRDPVY GCAGAICQLQ  120
KQVNELQAQL AKAQGELVNM QLQQANLVAL ICMEMAQSPQ ESPQQSVDNF ISTPPQSGGA  180
YQSGMNFFED NTSLNSLWEQ PLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971750.0BT097175.1 Soybean clone JCVI-FLGm-21N19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538040.11e-150PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-78LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0B2QKT81e-150A0A0B2QKT8_GLYSO; LOB domain-containing protein 1
TrEMBLI1LKC51e-150I1LKC5_SOYBN; Uncharacterized protein
STRINGGLYMA11G15810.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-79LOB domain-containing protein 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]